PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla000899
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB_related
Protein Properties Length: 351aa    MW: 38711.4 Da    PI: 7.4082
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla000899genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-13112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r +  +Rt+ q+ s+ qky
        Cla000899 112 PWTEEEHRLFLVGLQKLGKGDWRGISRNFVITRTPTQVASHAQKY 156
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.889105161IPR017930Myb domain
SuperFamilySSF466893.14E-17107162IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-18108160IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-11109155IPR009057Homeodomain-like
SMARTSM007173.4E-11109159IPR001005SANT/Myb domain
CDDcd001671.56E-9112157No hitNo description
PfamPF002497.2E-12112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGRTGSVTL PGGGGGVKLF GVRLTDGSFI KKSASMGNLS  60
VHYHSSSSAA ASPNPDSPNS DPVHDTDGFL SDDPAHASCS ANRRGERKKG VPWTEEEHRL  120
FLVGLQKLGK GDWRGISRNF VITRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMVPEMA  180
TDPLPVPEDD TLHASQTKET ENSSSQPSLN LSLNSEFHMM ETTVEENGKE FDAPKMEVAG  240
FPPVIPGFIP AYMPVPFPIW APSSFPVEEE NVVEMCRHEV LKPIPVVPKE PVNVDELVGM  300
SQLTLLEHER ERREPSPLAL KLIGKRSRQS AFHPNAPVSR SELNRDDNDT I
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462421.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462422.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462424.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462425.10.0PREDICTED: uncharacterized protein LOC103500780
TrEMBLA0A0A0K9S00.0A0A0A0K9S0_CUCSA; Uncharacterized protein
STRINGGLYMA13G43120.11e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.14e-86MYB_related family protein